PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017568P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NF-YB
Protein Properties Length: 226aa    MW: 24649.4 Da    PI: 8.2196
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017568P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB180.61.3e-5632127297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     +eqdrflPianvsrimkk lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plk+yl+kyre+e+e
  MELO3C017568P1  32 KEQDRFLPIANVSRIMKKSLPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKIYLNKYRETEEE 126
                     89*******************************************************************************************98 PP

           NF-YB  97 k 97 
                     k
  MELO3C017568P1 127 K 127
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-5428137IPR009072Histone-fold
SuperFamilySSF471138.38E-4134136IPR009072Histone-fold
PfamPF008081.2E-2737101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-196583No hitNo description
PROSITE patternPS0068506884IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-1984102No hitNo description
PRINTSPR006151.1E-19103121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSGQKRNFTT TTAVVSPVGS PTSGNISDSS TKEQDRFLPI ANVSRIMKKS LPANAKISKD  60
AKETVQECVS EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFENYV GPLKIYLNKY  120
RETEEEKHSL ARQEDPSLSP AKSSAEHIIG GKSANSVMDF QNFNSGFYSL GNQIQSQGSQ  180
KSFNIIDGVG FGENLRGFNI NGVHENGEGN RARAMAAHLQ QSSGW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4832122292Transcription factor HapC (Eurofung)
4g92_B3e-4832122292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818740.0LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453748.11e-168PREDICTED: nuclear transcription factor Y subunit B-like
TrEMBLA0A0A0KXV61e-163A0A0A0KXV6_CUCSA; Uncharacterized protein
STRINGPOPTR_0005s08510.11e-82(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-65nuclear factor Y, subunit B3